Lineage for d2a9wa_ (2a9w A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2578667Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2578668Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2578669Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2578767Protein Thymidylate synthase [55833] (7 species)
  7. 2578782Species Escherichia coli [TaxId:562] [55834] (71 PDB entries)
  8. 2578801Domain d2a9wa_: 2a9w A: [126456]
    automated match to d1an5a_
    complexed with 2br, bme, ga9, gol, po4, ump

Details for d2a9wa_

PDB Entry: 2a9w (more details), 1.65 Å

PDB Description: E. coli TS complexed with dUMP and inhibitor GA9
PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d2a9wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a9wa_ d.117.1.1 (A:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

SCOPe Domain Coordinates for d2a9wa_:

Click to download the PDB-style file with coordinates for d2a9wa_.
(The format of our PDB-style files is described here.)

Timeline for d2a9wa_: