Lineage for d2a9wa1 (2a9w A:1-264)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 732217Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 732218Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) (S)
  5. 732219Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins)
  6. 732247Protein Thymidylate synthase [55833] (7 species)
  7. 732262Species Escherichia coli [TaxId:562] [55834] (52 PDB entries)
  8. 732267Domain d2a9wa1: 2a9w A:1-264 [126456]
    automatically matched to d1tlca_
    complexed with 2br, bme, ga9, gol, po4, ump

Details for d2a9wa1

PDB Entry: 2a9w (more details), 1.65 Å

PDB Description: E. coli TS complexed with dUMP and inhibitor GA9
PDB Compounds: (A:) Thymidylate synthase

SCOP Domain Sequences for d2a9wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a9wa1 d.117.1.1 (A:1-264) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

SCOP Domain Coordinates for d2a9wa1:

Click to download the PDB-style file with coordinates for d2a9wa1.
(The format of our PDB-style files is described here.)

Timeline for d2a9wa1: