Lineage for d2a9ua1 (2a9u A:6-139)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 776180Superfamily a.118.23: USP8 N-terminal domain-like [140856] (1 family) (S)
  5. 776181Family a.118.23.1: USP8 N-terminal domain-like [140857] (1 protein)
    PfamB PB029795
  6. 776182Protein Ubiquitin carboxyl-terminal hydrolase 8, USH8 [140858] (1 species)
  7. 776183Species Human (Homo sapiens) [TaxId:9606] [140859] (1 PDB entry)
    Uniprot P40818 6-139
  8. 776184Domain d2a9ua1: 2a9u A:6-139 [126450]

Details for d2a9ua1

PDB Entry: 2a9u (more details), 2.1 Å

PDB Description: Structure of the N-terminal domain of Human Ubiquitin carboxyl-terminal hydrolase 8 (USP8)
PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 8

SCOP Domain Sequences for d2a9ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a9ua1 a.118.23.1 (A:6-139) Ubiquitin carboxyl-terminal hydrolase 8, USH8 {Human (Homo sapiens) [TaxId: 9606]}
svpkelylssslkdlnkktevkpekistksyvhsalkifktaeecrldrdeerayvlymk
yvtvynlikkrpdfkqqqdyfhsilgpgnikkaveeaerlseslklryeeaevrkkleek
drqeeaqrlqqkrq

SCOP Domain Coordinates for d2a9ua1:

Click to download the PDB-style file with coordinates for d2a9ua1.
(The format of our PDB-style files is described here.)

Timeline for d2a9ua1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2a9ub1