Lineage for d2a9sb1 (2a9s B:1-165)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 700602Fold c.51: Anticodon-binding domain-like [52953] (5 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 700825Superfamily c.51.5: CinA-like [142433] (1 family) (S)
  5. 700826Family c.51.5.1: CinA-like [142434] (1 protein)
    Pfam PF02464
  6. 700827Protein Competence/damage-inducible protein CinA [142435] (1 species)
  7. 700828Species Agrobacterium tumefaciens [TaxId:358] [142436] (1 PDB entry)
  8. 700830Domain d2a9sb1: 2a9s B:1-165 [126449]
    automatically matched to 2A9S A:1-167
    complexed with cl

Details for d2a9sb1

PDB Entry: 2a9s (more details), 1.75 Å

PDB Description: The crystal structure of competence/damage inducible protein CihA from Agrobacterium tumefaciens
PDB Compounds: (B:) competence/damage-inducible protein CinA

SCOP Domain Sequences for d2a9sb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a9sb1 c.51.5.1 (B:1-165) Competence/damage-inducible protein CinA {Agrobacterium tumefaciens [TaxId: 358]}
mslfpgdieelarriitdftplglmvstaesctggliagalteiagssavvdrgfvtytn
dakrdmlgvgtetlttfgavsrqtalqmahgalyrsranfavavtgiagpgggsaekpvg
lvhlatkarngnvlhhemrygdigrteirlatvrtalemlialnq

SCOP Domain Coordinates for d2a9sb1:

Click to download the PDB-style file with coordinates for d2a9sb1.
(The format of our PDB-style files is described here.)

Timeline for d2a9sb1: