Lineage for d2a9sb_ (2a9s B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2881870Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2882239Superfamily c.51.5: CinA-like [142433] (1 family) (S)
    automatically mapped to Pfam PF02464
  5. 2882240Family c.51.5.1: CinA-like [142434] (2 proteins)
    Pfam PF02464
  6. 2882244Protein automated matches [190467] (1 species)
    not a true protein
  7. 2882245Species Agrobacterium tumefaciens [TaxId:176299] [187387] (1 PDB entry)
  8. 2882246Domain d2a9sb_: 2a9s B: [126449]
    Other proteins in same PDB: d2a9sa1
    automated match to d2a9sa1
    complexed with cl

Details for d2a9sb_

PDB Entry: 2a9s (more details), 1.75 Å

PDB Description: The crystal structure of competence/damage inducible protein CihA from Agrobacterium tumefaciens
PDB Compounds: (B:) competence/damage-inducible protein CinA

SCOPe Domain Sequences for d2a9sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a9sb_ c.51.5.1 (B:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
mslfpgdieelarriitdftplglmvstaesctggliagalteiagssavvdrgfvtytn
dakrdmlgvgtetlttfgavsrqtalqmahgalyrsranfavavtgiagpgggsaekpvg
lvhlatkarngnvlhhemrygdigrteirlatvrtalemlialnq

SCOPe Domain Coordinates for d2a9sb_:

Click to download the PDB-style file with coordinates for d2a9sb_.
(The format of our PDB-style files is described here.)

Timeline for d2a9sb_: