![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
![]() | Superfamily c.51.5: CinA-like [142433] (1 family) ![]() automatically mapped to Pfam PF02464 |
![]() | Family c.51.5.1: CinA-like [142434] (2 proteins) Pfam PF02464 |
![]() | Protein automated matches [190467] (1 species) not a true protein |
![]() | Species Agrobacterium tumefaciens [TaxId:176299] [187387] (1 PDB entry) |
![]() | Domain d2a9sb_: 2a9s B: [126449] Other proteins in same PDB: d2a9sa1 automated match to d2a9sa1 complexed with cl |
PDB Entry: 2a9s (more details), 1.75 Å
SCOPe Domain Sequences for d2a9sb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a9sb_ c.51.5.1 (B:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]} mslfpgdieelarriitdftplglmvstaesctggliagalteiagssavvdrgfvtytn dakrdmlgvgtetlttfgavsrqtalqmahgalyrsranfavavtgiagpgggsaekpvg lvhlatkarngnvlhhemrygdigrteirlatvrtalemlialnq
Timeline for d2a9sb_: