Lineage for d2a9pa1 (2a9p A:2-118)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 691581Superfamily c.23.1: CheY-like [52172] (7 families) (S)
  5. 691582Family c.23.1.1: CheY-related [52173] (25 proteins)
  6. 691678Protein DNA-binding response regulator MicA, N-terminal domain [102232] (1 species)
  7. 691679Species Streptococcus pneumoniae [TaxId:1313] [102233] (11 PDB entries)
  8. 691681Domain d2a9pa1: 2a9p A:2-118 [126445]
    automatically matched to d1nxoa_
    complexed with bef, mn

Details for d2a9pa1

PDB Entry: 2a9p (more details), 1.82 Å

PDB Description: Medium Resolution BeF3 bound RR02-rec
PDB Compounds: (A:) Response regulator

SCOP Domain Sequences for d2a9pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]}
kkilivddekpisdiikfnmtkegyevvtafngrealeqfeaeqpdiiildlmlpeidgl
evaktirktssvpilmlsakdsefdkviglelgaddyvtkpfsnrelqarvkallrr

SCOP Domain Coordinates for d2a9pa1:

Click to download the PDB-style file with coordinates for d2a9pa1.
(The format of our PDB-style files is described here.)

Timeline for d2a9pa1: