Lineage for d2a9pa_ (2a9p A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855425Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2855544Protein DNA-binding response regulator MicA, N-terminal domain [102232] (1 species)
  7. 2855545Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [102233] (13 PDB entries)
  8. 2855547Domain d2a9pa_: 2a9p A: [126445]
    automated match to d1nxoa_
    complexed with bef, mn

Details for d2a9pa_

PDB Entry: 2a9p (more details), 1.82 Å

PDB Description: Medium Resolution BeF3 bound RR02-rec
PDB Compounds: (A:) Response regulator

SCOPe Domain Sequences for d2a9pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a9pa_ c.23.1.1 (A:) DNA-binding response regulator MicA, N-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
kkilivddekpisdiikfnmtkegyevvtafngrealeqfeaeqpdiiildlmlpeidgl
evaktirktssvpilmlsakdsefdkviglelgaddyvtkpfsnrelqarvkallrr

SCOPe Domain Coordinates for d2a9pa_:

Click to download the PDB-style file with coordinates for d2a9pa_.
(The format of our PDB-style files is described here.)

Timeline for d2a9pa_: