Lineage for d2a9oa1 (2a9o A:2-118)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 691581Superfamily c.23.1: CheY-like [52172] (7 families) (S)
  5. 691582Family c.23.1.1: CheY-related [52173] (25 proteins)
  6. 691678Protein DNA-binding response regulator MicA, N-terminal domain [102232] (1 species)
  7. 691679Species Streptococcus pneumoniae [TaxId:1313] [102233] (11 PDB entries)
  8. 691680Domain d2a9oa1: 2a9o A:2-118 [126444]
    automatically matched to d1nxoa_
    complexed with bef, mn

Details for d2a9oa1

PDB Entry: 2a9o (more details), 1.65 Å

PDB Description: Crystal structures of an activated YycF homologue, the essential response regulator from S.pneumoniae in complex with BeF3 and the effect of pH on BeF3 binding, possible phosphate in the active site
PDB Compounds: (A:) Response regulator

SCOP Domain Sequences for d2a9oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a9oa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]}
kkilivddekpisdiikfnmtkegyevvtafngrealeqfeaeqpdiiildlmlpeidgl
evaktirktssvpilmlsakdsefdkviglelgaddyvtkpfsnrelqarvkallrr

SCOP Domain Coordinates for d2a9oa1:

Click to download the PDB-style file with coordinates for d2a9oa1.
(The format of our PDB-style files is described here.)

Timeline for d2a9oa1: