![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
![]() | Family c.23.1.1: CheY-related [52173] (26 proteins) |
![]() | Protein DNA-binding response regulator MicA, N-terminal domain [102232] (1 species) |
![]() | Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [102233] (13 PDB entries) |
![]() | Domain d2a9oa_: 2a9o A: [126444] automated match to d1nxoa_ complexed with bef, mn |
PDB Entry: 2a9o (more details), 1.65 Å
SCOPe Domain Sequences for d2a9oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a9oa_ c.23.1.1 (A:) DNA-binding response regulator MicA, N-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} kkilivddekpisdiikfnmtkegyevvtafngrealeqfeaeqpdiiildlmlpeidgl evaktirktssvpilmlsakdsefdkviglelgaddyvtkpfsnrelqarvkallrr
Timeline for d2a9oa_: