SCOP 1.73: Domain d2a9ka1: 2a9k A:13-182

Lineage for d2a9ka1 (2a9k A:13-182)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Ras-related protein RalA [89662] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89663] (5 PDB entries)

8. Domain d2a9ka1: 2a9k A:13-182 [126442]
   Other proteins in same PDB: d2a9kb1
   automatically matched to d1uada_
   complexed with gdp, mg, nad

Details for d2a9ka1

PDB Entry: 2a9k, 1.73 Å

PDB Description: crystal structure of the c3bot-nad-rala complex reveals a novel type of action of a bacterial exoenzyme

PDB Compounds: (A:) Ras-related protein Ral-A

SCOP Domain Sequences for d2a9ka1:

Sequence; same for both SEQRES and ATOM records:

>d2a9ka1 c.37.1.8 (A:13-182) Ras-related protein RalA {Human (Homo sapiens) [TaxId: 9606]}
alhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildtagq
edyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksdle
dkrqvsveeaknraeqwnvnyvetsaktranvdkvffdlmreirarkmed

Timeline for d2a9ka1:

• d2a9ka1 is new in SCOP 1.73
  
• d2a9ka1 appears in SCOP 1.75
  
• d2a9ka1 appears in the current release, SCOPe 2.08, called d2a9ka_