Lineage for d2a9gd1 (2a9g D:6-417)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 732825Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 732826Superfamily d.126.1: Pentein [55909] (7 families) (S)
  5. 732856Family d.126.1.4: Arginine deiminase [103232] (1 protein)
    functionally related to the amidinotransferase, similar active sites
  6. 732857Protein Arginine deiminase [103233] (2 species)
  7. 732863Species Pseudomonas aeruginosa [TaxId:287] [103234] (5 PDB entries)
  8. 732867Domain d2a9gd1: 2a9g D:6-417 [126438]
    automatically matched to 2A9G A:6-417
    complexed with arg; mutant

Details for d2a9gd1

PDB Entry: 2a9g (more details), 2.3 Å

PDB Description: structure of c406a arginine deiminase in complex with l-arginine
PDB Compounds: (D:) Arginine deiminase

SCOP Domain Sequences for d2a9gd1:

Sequence, based on SEQRES records: (download)

>d2a9gd1 d.126.1.4 (D:6-417) Arginine deiminase {Pseudomonas aeruginosa [TaxId: 287]}
tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
gvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpmywpar
rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
rqaigqvaqslfakgaaervivaglpksraamhldtvfsfcdrdlvtvfpevvkeivpfs
lrpdpsspygmnirreektflevvaeslglkklrvvetggnsfaaereqwddgnnvvcle
pgvvvgydrntytntllrkagvevitisaselgrgrggghamtcpivrdpid

Sequence, based on observed residues (ATOM records): (download)

>d2a9gd1 d.126.1.4 (D:6-417) Arginine deiminase {Pseudomonas aeruginosa [TaxId: 287]}
tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
gvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpmywpar
rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
rqaigqvaqslfakgaaervivaglpksraamhldtvfsfcdrdlvtvfpevvkeivpfs
lrpdpsspygmnirreektflevvaeslglkklrvvetggreqwddgnnvvclepgvvvg
ydrntytntllrkagvevitisaselgrgrggghamtcpivrdpid

SCOP Domain Coordinates for d2a9gd1:

Click to download the PDB-style file with coordinates for d2a9gd1.
(The format of our PDB-style files is described here.)

Timeline for d2a9gd1: