Lineage for d2a9ga1 (2a9g A:6-417)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537906Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 2537907Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 2537944Family d.126.1.4: Arginine deiminase [103232] (1 protein)
    functionally related to the amidinotransferase, similar active sites
  6. 2537945Protein Arginine deiminase [103233] (2 species)
  7. 2537951Species Pseudomonas aeruginosa [TaxId:287] [103234] (5 PDB entries)
  8. 2537952Domain d2a9ga1: 2a9g A:6-417 [126435]
    complexed with arg

Details for d2a9ga1

PDB Entry: 2a9g (more details), 2.3 Å

PDB Description: Structure of C406A arginine deiminase in complex with L-arginine
PDB Compounds: (A:) Arginine deiminase

SCOPe Domain Sequences for d2a9ga1:

Sequence, based on SEQRES records: (download)

>d2a9ga1 d.126.1.4 (A:6-417) Arginine deiminase {Pseudomonas aeruginosa [TaxId: 287]}
tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
gvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpmywpar
rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
rqaigqvaqslfakgaaervivaglpksraamhldtvfsfcdrdlvtvfpevvkeivpfs
lrpdpsspygmnirreektflevvaeslglkklrvvetggnsfaaereqwddgnnvvcle
pgvvvgydrntytntllrkagvevitisaselgrgrggghamtcpivrdpid

Sequence, based on observed residues (ATOM records): (download)

>d2a9ga1 d.126.1.4 (A:6-417) Arginine deiminase {Pseudomonas aeruginosa [TaxId: 287]}
tklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrer
gidvlemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeylig
gvaaddlpaseganilkmyreylghssfllpplpntqftrdttcwiyggvtlnpmywpar
rqetllttaiykfhpefanaefeiwygdpdkdhgsstleggdvmpigngvvligmgerss
rqaigqvaqslfakgaaervivaglpksraamhldtvfsfcdrdlvtvfpevvkeivpfs
lrpdpsspygmnirreektflevvaeslglkklrvvetgreqwddgnnvvclepgvvvgy
drntytntllrkagvevitisaselgrgrggghamtcpivrdpid

SCOPe Domain Coordinates for d2a9ga1:

Click to download the PDB-style file with coordinates for d2a9ga1.
(The format of our PDB-style files is described here.)

Timeline for d2a9ga1: