Lineage for d2a9ba2 (2a9b A:95-343)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 738846Fold d.176: Oxidoreductase molybdopterin-binding domain [56523] (1 superfamily)
    unusual fold; contains 3 layers of beta-sheet structure and a beta-grasp like motif
  4. 738847Superfamily d.176.1: Oxidoreductase molybdopterin-binding domain [56524] (1 family) (S)
  5. 738848Family d.176.1.1: Oxidoreductase molybdopterin-binding domain [56525] (2 proteins)
    Pfam PF00174
  6. 738866Protein Sulfite oxidase, middle catalytic domain [56526] (2 species)
  7. 738867Species Chicken (Gallus gallus) [TaxId:9031] [56527] (5 PDB entries)
  8. 738873Domain d2a9ba2: 2a9b A:95-343 [126430]
    Other proteins in same PDB: d2a9ba1
    automatically matched to d1soxa3
    complexed with cl, mo, mte; mutant

Details for d2a9ba2

PDB Entry: 2a9b (more details), 2.5 Å

PDB Description: crystal structure of r138q mutant of recombinant sulfite oxidase at resting state
PDB Compounds: (A:) sulfite oxidase

SCOP Domain Sequences for d2a9ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a9ba2 d.176.1.1 (A:95-343) Sulfite oxidase, middle catalytic domain {Chicken (Gallus gallus) [TaxId: 9031]}
dpfagdpprhpglrvnsqkpfnaeppaellaerfltpnelfftqnhlpvpavepssyrlr
vdgpgggtlslslaelrsrfpkhevtatlqcagnrrsemsrvrpvkglpwdigaistarw
ggarlrdvllhagfpeelqgewhvcfegldadpggapygasipygralspaadvllayem
ngtelprdhgfpvrvvvpgvvgarsvkwlrrvavspdespshwqqndykgfspcvdwdtv
dyrtapaiq

SCOP Domain Coordinates for d2a9ba2:

Click to download the PDB-style file with coordinates for d2a9ba2.
(The format of our PDB-style files is described here.)

Timeline for d2a9ba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2a9ba1