![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.176: Oxidoreductase molybdopterin-binding domain [56523] (1 superfamily) unusual fold; contains 3 layers of beta-sheet structure and a beta-grasp like motif |
![]() | Superfamily d.176.1: Oxidoreductase molybdopterin-binding domain [56524] (1 family) ![]() |
![]() | Family d.176.1.1: Oxidoreductase molybdopterin-binding domain [56525] (2 proteins) Pfam PF00174 |
![]() | Protein Sulfite oxidase, middle catalytic domain [56526] (2 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [56527] (5 PDB entries) |
![]() | Domain d2a9ba2: 2a9b A:95-343 [126430] Other proteins in same PDB: d2a9ba1 automatically matched to d1soxa3 complexed with cl, mo, mte; mutant |
PDB Entry: 2a9b (more details), 2.5 Å
SCOP Domain Sequences for d2a9ba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a9ba2 d.176.1.1 (A:95-343) Sulfite oxidase, middle catalytic domain {Chicken (Gallus gallus) [TaxId: 9031]} dpfagdpprhpglrvnsqkpfnaeppaellaerfltpnelfftqnhlpvpavepssyrlr vdgpgggtlslslaelrsrfpkhevtatlqcagnrrsemsrvrpvkglpwdigaistarw ggarlrdvllhagfpeelqgewhvcfegldadpggapygasipygralspaadvllayem ngtelprdhgfpvrvvvpgvvgarsvkwlrrvavspdespshwqqndykgfspcvdwdtv dyrtapaiq
Timeline for d2a9ba2: