SCOPe 2.07: Domain d2a9ba1: 2a9b A:344-466

Lineage for d2a9ba1 (2a9b A:344-466)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.6: Molybdenum-containing oxidoreductases-like dimerisation domain [81286] (1 protein)
   automatically mapped to Pfam PF03404

6. Protein Sulfite oxidase, C-terminal domain [49259] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [49260] (6 PDB entries)

8. Domain d2a9ba1: 2a9b A:344-466 [126429]
   Other proteins in same PDB: d2a9ba2
   automated match to d1ogpa1
   complexed with cl, mo, mte; mutant

Details for d2a9ba1

PDB Entry: 2a9b, 2.5 Å

PDB Description: crystal structure of r138q mutant of recombinant sulfite oxidase at resting state

PDB Compounds: (A:) sulfite oxidase

SCOPe Domain Sequences for d2a9ba1:

Sequence; same for both SEQRES and ATOM records:

>d2a9ba1 b.1.18.6 (A:344-466) Sulfite oxidase, C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
elpvqsavtqprpgaavppgeltvkgyawsgggrevvrvdvsldggrtwkvarlmgdkap
pgrawawalweltvpveagteleivckavdssynvqpdsvapiwnlrgvlstawhrvrvs
vqd

Timeline for d2a9ba1:

• d2a9ba1 first appeared in SCOP 1.73
  
• d2a9ba1 appears in SCOPe 2.06
  
• d2a9ba1 appears in the current release, SCOPe 2.08