Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.6: Molybdenum-containing oxidoreductases-like dimerisation domain [81286] (1 protein) automatically mapped to Pfam PF03404 |
Protein Sulfite oxidase, C-terminal domain [49259] (2 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [49260] (6 PDB entries) |
Domain d2a9ba1: 2a9b A:344-466 [126429] Other proteins in same PDB: d2a9ba2 automated match to d1ogpa1 complexed with cl, mo, mte; mutant |
PDB Entry: 2a9b (more details), 2.5 Å
SCOPe Domain Sequences for d2a9ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a9ba1 b.1.18.6 (A:344-466) Sulfite oxidase, C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} elpvqsavtqprpgaavppgeltvkgyawsgggrevvrvdvsldggrtwkvarlmgdkap pgrawawalweltvpveagteleivckavdssynvqpdsvapiwnlrgvlstawhrvrvs vqd
Timeline for d2a9ba1: