Lineage for d2a9aa1 (2a9a A:344-466)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658571Superfamily b.1.18: E set domains [81296] (20 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 658973Family b.1.18.6: Molybdenum-containing oxidoreductases-like dimerisation domain [81286] (1 protein)
  6. 658974Protein Sulfite oxidase, C-terminal domain [49259] (2 species)
  7. 658975Species Chicken (Gallus gallus) [TaxId:9031] [49260] (5 PDB entries)
  8. 658979Domain d2a9aa1: 2a9a A:344-466 [126427]
    Other proteins in same PDB: d2a9aa2
    automatically matched to d1soxa1
    complexed with mo, mte, so4

Details for d2a9aa1

PDB Entry: 2a9a (more details), 2 Å

PDB Description: Crystal structure of recombinant chicken sulfite oxidase with the bound product, sulfate, at the active site
PDB Compounds: (A:) sulfite oxidase

SCOP Domain Sequences for d2a9aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a9aa1 b.1.18.6 (A:344-466) Sulfite oxidase, C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
elpvqsavtqprpgaavppgeltvkgyawsgggrevvrvdvsldggrtwkvarlmgdkap
pgrawawalweltvpveagteleivckavdssynvqpdsvapiwnlrgvlstawhrvrvs
vqd

SCOP Domain Coordinates for d2a9aa1:

Click to download the PDB-style file with coordinates for d2a9aa1.
(The format of our PDB-style files is described here.)

Timeline for d2a9aa1: