Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (20 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.6: Molybdenum-containing oxidoreductases-like dimerisation domain [81286] (1 protein) |
Protein Sulfite oxidase, C-terminal domain [49259] (2 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [49260] (5 PDB entries) |
Domain d2a9aa1: 2a9a A:344-466 [126427] Other proteins in same PDB: d2a9aa2 automatically matched to d1soxa1 complexed with mo, mte, so4 |
PDB Entry: 2a9a (more details), 2 Å
SCOP Domain Sequences for d2a9aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a9aa1 b.1.18.6 (A:344-466) Sulfite oxidase, C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} elpvqsavtqprpgaavppgeltvkgyawsgggrevvrvdvsldggrtwkvarlmgdkap pgrawawalweltvpveagteleivckavdssynvqpdsvapiwnlrgvlstawhrvrvs vqd
Timeline for d2a9aa1: