Lineage for d2a8wa1 (2a8w A:63-345)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 841352Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 841353Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (19 families) (S)
  5. 841590Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (3 proteins)
  6. 841625Protein Glycosyltransferase A catalytic domain [75276] (1 species)
    involved in blood group antigen biosynthesis
  7. 841626Species Human (Homo sapiens) [TaxId:9606] [75277] (19 PDB entries)
    Uniprot P16442 64-345
  8. 841633Domain d2a8wa1: 2a8w A:63-345 [126421]
    automatically matched to d1lz0a_
    complexed with cl, hg, mn, udp

Details for d2a8wa1

PDB Entry: 2a8w (more details), 1.59 Å

PDB Description: Crystal Structure of Human N-acetylgalactosaminyltransferase (GTA) Complexed with Beta-Methyllactoside
PDB Compounds: (A:) Histo-blood group ABO system transferase (NAGAT) [Includes: Glycoprotein-fucosylgalactoside alpha-N- acetylgalactosaminyltransferase (EC 2.4.1.40) (Fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase) (Histo-blood group A transferase) (A transferase); Glycoprotein-fucosylgalactoside alpha- galactosyltransferase (EC 2.4.1.37) (Fucosylglycoprotein 3-alpha- galactosyltransferase) (Histo-blood group B transferase) (B transferase)] [Contains: Fucosylglycoprotein alpha-N- acetylgalactosaminyltransferase, soluble form]

SCOP Domain Sequences for d2a8wa1:

Sequence, based on SEQRES records: (download)

>d2a8wa1 c.68.1.9 (A:63-345) Glycosyltransferase A catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
mvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfa
ikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevraykrwq
dvsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpgfygssre
aftyerrpqsqayipkdegdfyylggffggsvqevqrltrachqammvdqangieavwhd
eshlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavp

Sequence, based on observed residues (ATOM records): (download)

>d2a8wa1 c.68.1.9 (A:63-345) Glycosyltransferase A catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
mvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfa
ikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvleverrflse
vdylvcvdvdmefrdhvgveiltplfgtlhpgfygssreaftyerrpqsqayipkdegdf
yylggffggsvqevqrltrachqammvdqangieavwhdeshlnkyllrhkptkvlspey
lwdqqllgwpavlrklrftavp

SCOP Domain Coordinates for d2a8wa1:

Click to download the PDB-style file with coordinates for d2a8wa1.
(The format of our PDB-style files is described here.)

Timeline for d2a8wa1: