Lineage for d2a8sb_ (2a8s B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971309Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2971606Protein automated matches [190465] (6 species)
    not a true protein
  7. 2971607Species African clawed frog (Xenopus laevis) [TaxId:8355] [187382] (6 PDB entries)
  8. 2971614Domain d2a8sb_: 2a8s B: [126417]
    automated match to d1u20a1
    protein/RNA complex; complexed with gtp, mn

Details for d2a8sb_

PDB Entry: 2a8s (more details), 2.45 Å

PDB Description: 2.45 angstrom crystal structure of the complex between the nuclear snorna decapping nudix hydrolase x29, manganese and gtp
PDB Compounds: (B:) U8 snoRNA-binding protein X29

SCOPe Domain Sequences for d2a8sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a8sb_ d.113.1.1 (B:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
prnisreeslqlegykhachallhapsqaklfdrvpirrvllmmmrfdgrlgfpggfvdt
rdisleeglkreleeelgpalatvevteddyrssqvrehpqkcvthfyikelkleeieri
eaeavnakdhglevmglirvplytlrdrvgglpaflcnnfignsksqllyalrslkllre
dqiqevlkash

SCOPe Domain Coordinates for d2a8sb_:

Click to download the PDB-style file with coordinates for d2a8sb_.
(The format of our PDB-style files is described here.)

Timeline for d2a8sb_: