![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
![]() | Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
![]() | Family d.113.1.1: MutT-like [55812] (17 proteins) |
![]() | Protein automated matches [190465] (6 species) not a true protein |
![]() | Species African clawed frog (Xenopus laevis) [TaxId:8355] [187382] (6 PDB entries) |
![]() | Domain d2a8sa_: 2a8s A: [126416] automated match to d1u20a1 protein/RNA complex; complexed with gtp, mn |
PDB Entry: 2a8s (more details), 2.45 Å
SCOPe Domain Sequences for d2a8sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a8sa_ d.113.1.1 (A:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]} prnisreeslqlegykhachallhapsqaklfdrvpirrvllmmmrfdgrlgfpggfvdt rdisleeglkreleeelgpalatvevteddyrssqvrehpqkcvthfyikelkleeieri eaeavnakdhglevmglirvplytlrdrvgglpaflcnnfignsksqllyalrslkllre dqiqevlkashr
Timeline for d2a8sa_: