![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
![]() | Superfamily d.113.1: Nudix [55811] (7 families) ![]() |
![]() | Family d.113.1.1: MutT-like [55812] (16 proteins) |
![]() | Protein U8 snorna-binding protein x29 [143764] (1 species) nuclear decapping enzyme |
![]() | Species African clawed frog (Xenopus laevis) [TaxId:8355] [143765] (6 PDB entries) |
![]() | Domain d2a8rb1: 2a8r B:18-208 [126415] automatically matched to 1U20 A:14-209 complexed with mn, pop, ycm |
PDB Entry: 2a8r (more details), 2.45 Å
SCOP Domain Sequences for d2a8rb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a8rb1 d.113.1.1 (B:18-208) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} prnisreeslqlegykhachallhapsqaklfdrvpirrvllmmmrfdgrlgfpggfvdt rdisleeglkreleeelgpalatvevteddyrssqvrehpqkcvthfyikelkleeieri eaeavnakdhglevmglirvplytlrdrvgglpaflcnnfignsksqllyalrslkllre dqiqevlkash
Timeline for d2a8rb1: