Lineage for d2a8rb_ (2a8r B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2535539Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2535540Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2535541Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2535725Protein automated matches [190465] (6 species)
    not a true protein
  7. 2535726Species African clawed frog (Xenopus laevis) [TaxId:8355] [187382] (6 PDB entries)
  8. 2535735Domain d2a8rb_: 2a8r B: [126415]
    automated match to d1u20a1
    protein/RNA complex; complexed with mn, pop

Details for d2a8rb_

PDB Entry: 2a8r (more details), 2.45 Å

PDB Description: 2.45 angstrom crystal structure of the complex between the nuclear snorna decapping nudix hydrolase x29 and manganese in the presence of 7-methyl-gtp
PDB Compounds: (B:) U8 snoRNA-binding protein X29

SCOPe Domain Sequences for d2a8rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a8rb_ d.113.1.1 (B:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
prnisreeslqlegykhachallhapsqaklfdrvpirrvllmmmrfdgrlgfpggfvdt
rdisleeglkreleeelgpalatvevteddyrssqvrehpqkcvthfyikelkleeieri
eaeavnakdhglevmglirvplytlrdrvgglpaflcnnfignsksqllyalrslkllre
dqiqevlkash

SCOPe Domain Coordinates for d2a8rb_:

Click to download the PDB-style file with coordinates for d2a8rb_.
(The format of our PDB-style files is described here.)

Timeline for d2a8rb_: