SCOPe 2.07: Domain d2a8pa_: 2a8p A:

Lineage for d2a8pa_ (2a8p A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.1: MutT-like [55812] (17 proteins)

6. Protein automated matches [190465] (6 species)
   not a true protein

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [187382] (6 PDB entries)

8. Domain d2a8pa_: 2a8p A: [126410]
   automated match to d1u20a1
   protein/RNA complex; complexed with mn

Details for d2a8pa_

PDB Entry: 2a8p, 2.7 Å

PDB Description: 2.7 Angstrom Crystal Structure of the Complex Between the Nuclear SnoRNA Decapping Nudix Hydrolase X29 and Manganese

PDB Compounds: (A:) U8 snoRNA-binding protein X29

SCOPe Domain Sequences for d2a8pa_:

Sequence; same for both SEQRES and ATOM records:

>d2a8pa_ d.113.1.1 (A:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
prnisreeslqlegykhachallhapsqaklfdrvpirrvllmmmrfdgrlgfpggfvdt
rdisleeglkreleeelgpalatvevteddyrssqvrehpqkcvthfyikelkleeieri
eaeavnakdhglevmglirvplytlrdrvgglpaflcnnfignsksqllyalrslkllre
dqiqevlkashr

Timeline for d2a8pa_:

• d2a8pa_ first appeared in SCOP 1.73, called d2a8pa1
  
• d2a8pa_ appears in SCOPe 2.06
  
• d2a8pa_ appears in the current release, SCOPe 2.08