Lineage for d2a8pa1 (2a8p A:18-209)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 731929Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 731930Superfamily d.113.1: Nudix [55811] (7 families) (S)
  5. 731931Family d.113.1.1: MutT-like [55812] (16 proteins)
  6. 732044Protein U8 snorna-binding protein x29 [143764] (1 species)
    nuclear decapping enzyme
  7. 732045Species African clawed frog (Xenopus laevis) [TaxId:8355] [143765] (6 PDB entries)
  8. 732056Domain d2a8pa1: 2a8p A:18-209 [126410]
    automatically matched to 1U20 A:14-209
    complexed with mn, ycm

Details for d2a8pa1

PDB Entry: 2a8p (more details), 2.7 Å

PDB Description: 2.7 Angstrom Crystal Structure of the Complex Between the Nuclear SnoRNA Decapping Nudix Hydrolase X29 and Manganese
PDB Compounds: (A:) U8 snoRNA-binding protein X29

SCOP Domain Sequences for d2a8pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a8pa1 d.113.1.1 (A:18-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
prnisreeslqlegykhachallhapsqaklfdrvpirrvllmmmrfdgrlgfpggfvdt
rdisleeglkreleeelgpalatvevteddyrssqvrehpqkcvthfyikelkleeieri
eaeavnakdhglevmglirvplytlrdrvgglpaflcnnfignsksqllyalrslkllre
dqiqevlkashr

SCOP Domain Coordinates for d2a8pa1:

Click to download the PDB-style file with coordinates for d2a8pa1.
(The format of our PDB-style files is described here.)

Timeline for d2a8pa1: