SCOP 1.73: Domain d2a8nb1: 2a8n B:4-131

Lineage for d2a8nb1 (2a8n B:4-131)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (4 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (7 proteins)
   strand 5 is parallel to strand 4

6. Protein Cytidine and deoxycytidylate deaminase CodA [142835] (1 species)

7. Species Agrobacterium tumefaciens [TaxId:358] [142836] (1 PDB entry)

8. Domain d2a8nb1: 2a8n B:4-131 [126409]
   automatically matched to 2A8N A:2-131
   complexed with zn

Details for d2a8nb1

PDB Entry: 2a8n, 1.6 Å

PDB Description: Biochemical and Structural Studies of A-to-I Editing by tRNA:A34 Deaminases at the Wobble Position of Transfer RNA

PDB Compounds: (B:) cytidine and deoxycytidylate deaminase

SCOP Domain Sequences for d2a8nb1:

Sequence; same for both SEQRES and ATOM records:

>d2a8nb1 c.97.1.2 (B:4-131) Cytidine and deoxycytidylate deaminase CodA {Agrobacterium tumefaciens [TaxId: 358]}
rthfmelalvearsagerdevpigavlvldgrviarsgnrtrelndvtahaeiavirmac
ealgqerlpgadlyvtlepctmcaaaisfarirrlyygaqdpkggavesgvrffsqptch
hapdvysg

Timeline for d2a8nb1:

• d2a8nb1 is new in SCOP 1.73
  
• d2a8nb1 appears in SCOP 1.75
  
• d2a8nb1 appears in the current release, SCOPe 2.08, called d2a8nb_