Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) contains extra C-terminal strand 5, order 21345 |
Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins) strand 5 is parallel to strand 4 |
Protein Cytidine and deoxycytidylate deaminase CodA [142835] (1 species) |
Species Agrobacterium tumefaciens [TaxId:358] [142836] (1 PDB entry) Uniprot Q8UHJ4 2-131 |
Domain d2a8nb_: 2a8n B: [126409] automated match to d2a8na1 complexed with zn |
PDB Entry: 2a8n (more details), 1.6 Å
SCOPe Domain Sequences for d2a8nb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a8nb_ c.97.1.2 (B:) Cytidine and deoxycytidylate deaminase CodA {Agrobacterium tumefaciens [TaxId: 358]} rthfmelalvearsagerdevpigavlvldgrviarsgnrtrelndvtahaeiavirmac ealgqerlpgadlyvtlepctmcaaaisfarirrlyygaqdpkggavesgvrffsqptch hapdvysglaesesaeil
Timeline for d2a8nb_: