Lineage for d2a8kc1 (2a8k C:12-105)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 740813Fold d.243: Colicin D/E5 nuclease domain [102823] (1 superfamily)
    alpha(2)-beta(4)-alpha, 2 layers: alpha/beta, antiparallel beta sheet, meander
  4. 740814Superfamily d.243.1: Colicin D/E5 nuclease domain [102824] (2 families) (S)
  5. 740820Family d.243.1.2: Colicin E5 nuclease domain [143007] (1 protein)
  6. 740821Protein Colicin E5 [143008] (1 species)
  7. 740822Species Escherichia coli [TaxId:562] [143009] (4 PDB entries)
  8. 740826Domain d2a8kc1: 2a8k C:12-105 [126406]
    automatically matched to 2A8K A:12-105
    complexed with ca; mutant

Details for d2a8kc1

PDB Entry: 2a8k (more details), 1.5 Å

PDB Description: Structural and Mutational Studies of the Catalytic Domain of Colicin E5a tRNA-Specific Ribonuclease
PDB Compounds: (C:) Colicin E5

SCOP Domain Sequences for d2a8kc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a8kc1 d.243.1.2 (C:12-105) Colicin E5 {Escherichia coli [TaxId: 562]}
lkidqkirgqmpergwteddikntvsngatgtsfdkrspkktppdylgrndpatvygspg
kyvvvndrtgevtqisdktdpgwvddsriqwgnk

SCOP Domain Coordinates for d2a8kc1:

Click to download the PDB-style file with coordinates for d2a8kc1.
(The format of our PDB-style files is described here.)

Timeline for d2a8kc1: