![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.243: Colicin D/E5 nuclease domain [102823] (1 superfamily) alpha(2)-beta(4)-alpha, 2 layers: alpha/beta, antiparallel beta sheet, meander |
![]() | Superfamily d.243.1: Colicin D/E5 nuclease domain [102824] (2 families) ![]() |
![]() | Family d.243.1.2: Colicin E5 nuclease domain [143007] (2 proteins) |
![]() | Protein Colicin E5 [143008] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [143009] (4 PDB entries) Uniprot P18000 84-177 |
![]() | Domain d2a8kc_: 2a8k C: [126406] automated match to d2a8ka1 complexed with ca; mutant |
PDB Entry: 2a8k (more details), 1.5 Å
SCOPe Domain Sequences for d2a8kc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a8kc_ d.243.1.2 (C:) Colicin E5 {Escherichia coli [TaxId: 562]} lkidqkirgqmpergwteddikntvsngatgtsfdkrspkktppdylgrndpatvygspg kyvvvndrtgevtqisdktdpgwvddsriqwgnk
Timeline for d2a8kc_: