Lineage for d2a8kb_ (2a8k B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008616Fold d.243: Colicin D/E5 nuclease domain [102823] (1 superfamily)
    alpha(2)-beta(4)-alpha, 2 layers: alpha/beta, antiparallel beta sheet, meander
  4. 3008617Superfamily d.243.1: Colicin D/E5 nuclease domain [102824] (2 families) (S)
  5. 3008624Family d.243.1.2: Colicin E5 nuclease domain [143007] (2 proteins)
  6. 3008625Protein Colicin E5 [143008] (1 species)
  7. 3008626Species Escherichia coli [TaxId:562] [143009] (4 PDB entries)
    Uniprot P18000 84-177
  8. 3008629Domain d2a8kb_: 2a8k B: [126405]
    automated match to d2a8ka1
    complexed with ca; mutant

Details for d2a8kb_

PDB Entry: 2a8k (more details), 1.5 Å

PDB Description: Structural and Mutational Studies of the Catalytic Domain of Colicin E5a tRNA-Specific Ribonuclease
PDB Compounds: (B:) Colicin E5

SCOPe Domain Sequences for d2a8kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a8kb_ d.243.1.2 (B:) Colicin E5 {Escherichia coli [TaxId: 562]}
lkidqkirgqmpergwteddikntvsngatgtsfdkrspkktppdylgrndpatvygspg
kyvvvndrtgevtqisdktdpgwvddsriqwgnk

SCOPe Domain Coordinates for d2a8kb_:

Click to download the PDB-style file with coordinates for d2a8kb_.
(The format of our PDB-style files is described here.)

Timeline for d2a8kb_: