Lineage for d2a8hb1 (2a8h B:219-473)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 729090Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 729091Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) (S)
  5. 729326Family d.92.1.10: TNF-alpha converting enzyme, TACE, catalytic domain [55525] (1 protein)
  6. 729327Protein TNF-alpha converting enzyme, TACE, catalytic domain [55526] (1 species)
  7. 729328Species Human (Homo sapiens) [TaxId:9606] [55527] (4 PDB entries)
  8. 729336Domain d2a8hb1: 2a8h B:219-473 [126403]
    automatically matched to d1bkca_
    complexed with 4nh, zn; mutant

Details for d2a8hb1

PDB Entry: 2a8h (more details), 2.3 Å

PDB Description: crystal structure of catalytic domain of tace with thiomorpholine sulfonamide hydroxamate inhibitor
PDB Compounds: (B:) adam 17

SCOP Domain Sequences for d2a8hb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a8hb1 d.92.1.10 (B:219-473) TNF-alpha converting enzyme, TACE, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dpmkntckllvvadhrfyrymgrgeestttnylielidrvddiyrntawdnagfkgygiq
ieqirilkspqevkpgekhynmaksypneekdawdvkmlleqfsfdiaeeaskvclahlf
tyqdfdmgtlglayvgspranshggvcpkayyspvgkkniylnsgltstknygktiltke
adlvtthelghnfgaehdpdglaecapnedqggkyvmypiavsgdhennkmfsqcskqsi
yktieskaqecfqer

SCOP Domain Coordinates for d2a8hb1:

Click to download the PDB-style file with coordinates for d2a8hb1.
(The format of our PDB-style files is described here.)

Timeline for d2a8hb1: