![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.10: TNF-alpha converting enzyme, TACE, catalytic domain [55525] (2 proteins) automatically mapped to Pfam PF13574 automatically mapped to Pfam PF13583 |
![]() | Protein TNF-alpha converting enzyme, TACE, catalytic domain [55526] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55527] (20 PDB entries) |
![]() | Domain d2a8hb_: 2a8h B: [126403] automated match to d1bkce_ complexed with 4nh, zn |
PDB Entry: 2a8h (more details), 2.3 Å
SCOPe Domain Sequences for d2a8hb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a8hb_ d.92.1.10 (B:) TNF-alpha converting enzyme, TACE, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} pdpmkntckllvvadhrfyrymgrgeestttnylielidrvddiyrntawdnagfkgygi qieqirilkspqevkpgekhynmaksypneekdawdvkmlleqfsfdiaeeaskvclahl ftyqdfdmgtlglayvgspranshggvcpkayyspvgkkniylnsgltstknygktiltk eadlvtthelghnfgaehdpdglaecapnedqggkyvmypiavsgdhennkmfsqcskqs iyktieskaqecfqers
Timeline for d2a8hb_: