SCOPe 2.08: Domain d2a8hb_: 2a8h B:

Lineage for d2a8hb_ (2a8h B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.10: TNF-alpha converting enzyme, TACE, catalytic domain [55525] (2 proteins)
   automatically mapped to Pfam PF13574
   automatically mapped to Pfam PF13583

6. Protein TNF-alpha converting enzyme, TACE, catalytic domain [55526] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55527] (20 PDB entries)

8. Domain d2a8hb_: 2a8h B: [126403]
   automated match to d1bkce_
   complexed with 4nh, zn

Details for d2a8hb_

PDB Entry: 2a8h, 2.3 Å

PDB Description: crystal structure of catalytic domain of tace with thiomorpholine sulfonamide hydroxamate inhibitor

PDB Compounds: (B:) adam 17

SCOPe Domain Sequences for d2a8hb_:

Sequence; same for both SEQRES and ATOM records:

>d2a8hb_ d.92.1.10 (B:) TNF-alpha converting enzyme, TACE, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
pdpmkntckllvvadhrfyrymgrgeestttnylielidrvddiyrntawdnagfkgygi
qieqirilkspqevkpgekhynmaksypneekdawdvkmlleqfsfdiaeeaskvclahl
ftyqdfdmgtlglayvgspranshggvcpkayyspvgkkniylnsgltstknygktiltk
eadlvtthelghnfgaehdpdglaecapnedqggkyvmypiavsgdhennkmfsqcskqs
iyktieskaqecfqers

Timeline for d2a8hb_:

• d2a8hb_ first appeared in SCOP 1.73, called d2a8hb1
  
• d2a8hb_ appears in SCOPe 2.07