Lineage for d2a8ha_ (2a8h A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964179Family d.92.1.10: TNF-alpha converting enzyme, TACE, catalytic domain [55525] (2 proteins)
    automatically mapped to Pfam PF13574
    automatically mapped to Pfam PF13583
  6. 2964180Protein TNF-alpha converting enzyme, TACE, catalytic domain [55526] (1 species)
  7. 2964181Species Human (Homo sapiens) [TaxId:9606] [55527] (20 PDB entries)
  8. 2964213Domain d2a8ha_: 2a8h A: [126402]
    automated match to d1bkce_
    complexed with 4nh, zn

Details for d2a8ha_

PDB Entry: 2a8h (more details), 2.3 Å

PDB Description: crystal structure of catalytic domain of tace with thiomorpholine sulfonamide hydroxamate inhibitor
PDB Compounds: (A:) adam 17

SCOPe Domain Sequences for d2a8ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a8ha_ d.92.1.10 (A:) TNF-alpha converting enzyme, TACE, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dpdpmkntckllvvadhrfyrymgrgeestttnylielidrvddiyrntawdnagfkgyg
iqieqirilkspqevkpgekhynmaksypneekdawdvkmlleqfsfdiaeeaskvclah
lftyqdfdmgtlglayvgspranshggvcpkayyspvgkkniylnsgltstknygktilt
keadlvtthelghnfgaehdpdglaecapnedqggkyvmypiavsgdhennkmfsqcskq
siyktieskaqecfqersn

SCOPe Domain Coordinates for d2a8ha_:

Click to download the PDB-style file with coordinates for d2a8ha_.
(The format of our PDB-style files is described here.)

Timeline for d2a8ha_: