SCOP 1.73: Domain d2a8gb1: 2a8g B:3-123

Lineage for d2a8gb1 (2a8g B:3-123)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (1 family)

5. Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)

6. Protein Avidin [50880] (1 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [50881] (13 PDB entries)

8. Domain d2a8gb1: 2a8g B:3-123 [126401]
   automatically matched to d1avdb_
   complexed with gng, nag

Details for d2a8gb1

PDB Entry: 2a8g, 1.99 Å

PDB Description: structure of avidin in complex with the ligand deoxyguanosine

PDB Compounds: (B:) Avidin

SCOP Domain Sequences for d2a8gb1:

Sequence; same for both SEQRES and ATOM records:

>d2a8gb1 b.61.1.1 (B:3-123) Avidin {Chicken (Gallus gallus) [TaxId: 9031]}
kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
l

Timeline for d2a8gb1:

• d2a8gb1 is new in SCOP 1.73
  
• d2a8gb1 appears in SCOP 1.75
  
• d2a8gb1 appears in the current release, SCOPe 2.08, called d2a8gb_