Lineage for d2a8ga_ (2a8g A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2805787Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2805788Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2806126Protein automated matches [190191] (2 species)
    not a true protein
  7. 2806127Species Chicken (Gallus gallus) [TaxId:9031] [186931] (28 PDB entries)
  8. 2806188Domain d2a8ga_: 2a8g A: [126400]
    automated match to d1avda_
    complexed with gng, nag

Details for d2a8ga_

PDB Entry: 2a8g (more details), 1.99 Å

PDB Description: structure of avidin in complex with the ligand deoxyguanosine
PDB Compounds: (A:) Avidin

SCOPe Domain Sequences for d2a8ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a8ga_ b.61.1.1 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrtqp
tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
l

SCOPe Domain Coordinates for d2a8ga_:

Click to download the PDB-style file with coordinates for d2a8ga_.
(The format of our PDB-style files is described here.)

Timeline for d2a8ga_: