Lineage for d2a8ea1 (2a8e A:2-211)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2615942Fold d.296: YktB/PF0168-like [142912] (1 superfamily)
    alpha-beta(4)-alpha-beta(2)-alpha-beta-alpha; 2 layers, a/b; antiparallel beta-sheet, order: 1234756; half-barrel shape; topological similarity to the MotA C-terminal domain-like fold (69651) and the Secretion chaperone-like fold (69634)
  4. 2615943Superfamily d.296.1: YktB/PF0168-like [142913] (2 families) (S)
  5. 2615944Family d.296.1.1: YktB-like [142914] (1 protein)
    Pfam PF06335; DUF1054
  6. 2615945Protein Hypothetical protein YktB [142915] (1 species)
  7. 2615946Species Bacillus subtilis [TaxId:1423] [142916] (1 PDB entry)
    Uniprot Q45498 2-211
  8. 2615947Domain d2a8ea1: 2a8e A:2-211 [126397]
    complexed with peg, so4

Details for d2a8ea1

PDB Entry: 2a8e (more details), 2.5 Å

PDB Description: Three-dimensional structure of Bacillus subtilis Q45498 putative protein at resolution 2.5A. Northeast Structural Genomics Consortium target SR204.
PDB Compounds: (A:) hypothetical protein yktB

SCOPe Domain Sequences for d2a8ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a8ea1 d.296.1.1 (A:2-211) Hypothetical protein YktB {Bacillus subtilis [TaxId: 1423]}
tqmrfteedfntftiegldarmevlketvrpkltalgehfaptlsaltgdemfphvakha
rrsvnppadswvafanskrgykklphfqiglweshvfvwfaiiyespikeeygkllevnq
etitknipdsfvwsadhtkpgvhkqsemdkeqlktlferlqtvkkaellcgiqlqkeevl
nmnnqeflqriddafkqlaflyrltqkvtq

SCOPe Domain Coordinates for d2a8ea1:

Click to download the PDB-style file with coordinates for d2a8ea1.
(The format of our PDB-style files is described here.)

Timeline for d2a8ea1: