![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.296: YktB/PF0168-like [142912] (1 superfamily) alpha-beta(4)-alpha-beta(2)-alpha-beta-alpha; 2 layers, a/b; antiparallel beta-sheet, order: 1234756; half-barrel shape; topological similarity to the MotA C-terminal domain-like fold (scop_cf 69651) and the Secretion chaperone-like fold (scop_cf 69634) |
![]() | Superfamily d.296.1: YktB/PF0168-like [142913] (2 families) ![]() |
![]() | Family d.296.1.1: YktB-like [142914] (1 protein) Pfam PF06335; DUF1054 |
![]() | Protein Hypothetical protein YktB [142915] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [142916] (1 PDB entry) |
![]() | Domain d2a8ea1: 2a8e A:2-211 [126397] complexed with peg, so4 |
PDB Entry: 2a8e (more details), 2.5 Å
SCOP Domain Sequences for d2a8ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a8ea1 d.296.1.1 (A:2-211) Hypothetical protein YktB {Bacillus subtilis [TaxId: 1423]} tqmrfteedfntftiegldarmevlketvrpkltalgehfaptlsaltgdemfphvakha rrsvnppadswvafanskrgykklphfqiglweshvfvwfaiiyespikeeygkllevnq etitknipdsfvwsadhtkpgvhkqsemdkeqlktlferlqtvkkaellcgiqlqkeevl nmnnqeflqriddafkqlaflyrltqkvtq
Timeline for d2a8ea1: