![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
![]() | Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) ![]() N-terminal domain is beta/beta/alpha common fold |
![]() | Family d.16.1.3: D-aminoacid oxidase-like [54384] (3 proteins) |
![]() | Protein Sarcosine oxidase [54388] (1 species) |
![]() | Species Bacillus sp., strain b0618 [TaxId:1409] [54389] (16 PDB entries) |
![]() | Domain d2a89b2: 2a89 B:218-321 [126396] Other proteins in same PDB: d2a89a1, d2a89b1 automated match to d1l9ea2 complexed with cl, fcg, po4 |
PDB Entry: 2a89 (more details), 1.85 Å
SCOPe Domain Sequences for d2a89b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a89b2 d.16.1.3 (B:218-321) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} lqpyrqvvgffesdeskysndidfpgfmvevpngiyygfpsfggcglklgyhtfgqkidp dtinrefgvypedesnlrafleeympgangelkrgavcmytktl
Timeline for d2a89b2: