SCOP 1.75: Domain d2a89b2: 2a89 B:218-321

Lineage for d2a89b2 (2a89 B:218-321)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.3: D-aminoacid oxidase-like [54384] (3 proteins)

6. Protein Sarcosine oxidase [54388] (1 species)

7. Species Bacillus sp., strain b0618 [TaxId:1409] [54389] (13 PDB entries)

8. Domain d2a89b2: 2a89 B:218-321 [126396]
   Other proteins in same PDB: d2a89a1, d2a89b1
   automatically matched to d1el5a2
   complexed with cl, fcg, po4

Details for d2a89b2

PDB Entry: 2a89, 1.85 Å

PDB Description: monomeric sarcosine oxidase: structure of a covalently flavinylated amine oxidizing enzyme

PDB Compounds: (B:) Monomeric sarcosine oxidase

SCOP Domain Sequences for d2a89b2:

Sequence; same for both SEQRES and ATOM records:

>d2a89b2 d.16.1.3 (B:218-321) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]}
lqpyrqvvgffesdeskysndidfpgfmvevpngiyygfpsfggcglklgyhtfgqkidp
dtinrefgvypedesnlrafleeympgangelkrgavcmytktl

Timeline for d2a89b2:

• d2a89b2 first appeared in SCOP 1.73
  
• d2a89b2 appears in SCOPe 2.01
  
• d2a89b2 appears in the current release, SCOPe 2.08