Lineage for d2a86b1 (2a86 B:3-288)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 693366Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 693367Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 693653Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (1 protein)
    contains C-terminal subdomain similar to one structural repeat of the Creatinase/aminopeptidase family
  6. 693654Protein Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63977] (3 species)
  7. 693658Species Mycobacterium tuberculosis [TaxId:1773] [89615] (12 PDB entries)
  8. 693671Domain d2a86b1: 2a86 B:3-288 [126391]
    automatically matched to d1n2ga_
    complexed with amp, bal, eoh, gol, so4; mutant

Details for d2a86b1

PDB Entry: 2a86 (more details), 1.85 Å

PDB Description: Crystal structure of A Pantothenate synthetase complexed with AMP and beta-alanine
PDB Compounds: (B:) Pantoate--beta-alanine ligase

SCOP Domain Sequences for d2a86b1:

Sequence, based on SEQRES records: (download)

>d2a86b1 c.26.1.4 (B:3-288) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Mycobacterium tuberculosis [TaxId: 1773]}
ipafhpgelnvysapgdvadvsralrltgrrvmlvptmgalheghlalvraakrvpgsvv
vvsifvnpmqfgaggdldayprtpdddlaqlraegveiaftpttaamypdglrttvqpgp
laaeleggprpthfagvltvvlkllqivrpdrvffgekdyqqlvlirqlvadfnldvavv
gvptvreadglamssrnryldpaqraaavalsaaltaaahaatagaqaaldaaravldaa
pgvavdylelrdiglgpmplngsgrllvaarlgttrlldniaieig

Sequence, based on observed residues (ATOM records): (download)

>d2a86b1 c.26.1.4 (B:3-288) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Mycobacterium tuberculosis [TaxId: 1773]}
ipafhpgelnvysapgdvadvsralrltgrrvmlvptmgalheghlalvraakrvpgsvv
vvsifvnpmqfrtpdddlaqlraegveiaftpttaamypdglrttvqpgplaaeleggpr
pthfagvltvvlkllqivrpdrvffgekdyqqlvlirqlvadfnldvavvgvptvreadg
lamssrnryldpaqraaavalsaaltaaahaatagaqaaldaaravldaapgvavdylel
rdiglgpmplngsgrllvaarlgttrlldniaieig

SCOP Domain Coordinates for d2a86b1:

Click to download the PDB-style file with coordinates for d2a86b1.
(The format of our PDB-style files is described here.)

Timeline for d2a86b1: