Lineage for d2a83a2 (2a83 A:1-181)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2544723Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2545007Species Human (Homo sapiens), HLA-BW44 [TaxId:9606] [102837] (19 PDB entries)
    Uniprot P30481 25-300
  8. 2545010Domain d2a83a2: 2a83 A:1-181 [126387]
    Other proteins in same PDB: d2a83a1, d2a83b2, d2a83b3
    automatically matched to d1m6oa2
    complexed with gol, na

Details for d2a83a2

PDB Entry: 2a83 (more details), 1.4 Å

PDB Description: crystal structure of hla-b*2705 complexed with the glucagon receptor (gr) peptide (residues 412-420)
PDB Compounds: (A:) HLA class I histocompatibility antigen, B-27 alpha chain

SCOPe Domain Sequences for d2a83a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a83a2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-BW44 [TaxId: 9606]}
gshsmryfhtsvsrpgrgeprfitvgyvddtlfvrfdsdaaspreeprapwieqegpeyw
dretqickakaqtdredlrtllryynqseagshtlqnmygcdvgpdgrllrgyhqdaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlraylegecvewlrrylengketlq
r

SCOPe Domain Coordinates for d2a83a2:

Click to download the PDB-style file with coordinates for d2a83a2.
(The format of our PDB-style files is described here.)

Timeline for d2a83a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2a83a1