| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species) |
| Species Human (Homo sapiens), HLA-BW44 [TaxId:9606] [102837] (12 PDB entries) Uniprot P30481 25-300 |
| Domain d2a83a2: 2a83 A:1-181 [126387] Other proteins in same PDB: d2a83a1, d2a83b_ automatically matched to d1m6oa2 complexed with gol, na |
PDB Entry: 2a83 (more details), 1.4 Å
SCOPe Domain Sequences for d2a83a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a83a2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-BW44 [TaxId: 9606]}
gshsmryfhtsvsrpgrgeprfitvgyvddtlfvrfdsdaaspreeprapwieqegpeyw
dretqickakaqtdredlrtllryynqseagshtlqnmygcdvgpdgrllrgyhqdaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlraylegecvewlrrylengketlq
r
Timeline for d2a83a2: