Lineage for d2a83a1 (2a83 A:182-276)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654537Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 654538Species Human (Homo sapiens) [TaxId:9606] [88605] (130 PDB entries)
  8. 654540Domain d2a83a1: 2a83 A:182-276 [126386]
    Other proteins in same PDB: d2a83a2, d2a83b1
    automatically matched to d1m6oa1
    complexed with gol, na

Details for d2a83a1

PDB Entry: 2a83 (more details), 1.4 Å

PDB Description: crystal structure of hla-b*2705 complexed with the glucagon receptor (gr) peptide (residues 412-420)
PDB Compounds: (A:) HLA class I histocompatibility antigen, B-27 alpha chain

SCOP Domain Sequences for d2a83a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a83a1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
adppkthvthhpisdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwep

SCOP Domain Coordinates for d2a83a1:

Click to download the PDB-style file with coordinates for d2a83a1.
(The format of our PDB-style files is described here.)

Timeline for d2a83a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2a83a2
View in 3D
Domains from other chains:
(mouse over for more information)
d2a83b1