SCOPe 2.07: Domain d2a81c_: 2a81 C:

Lineage for d2a81c_ (2a81 C:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (70 species)
   not a true protein

7. Species Pectobacterium carotovorum [TaxId:554] [255028] (1 PDB entry)

8. Domain d2a81c_: 2a81 C: [126385]
   automated match to d4fzwc_
   complexed with aco, bcn

Details for d2a81c_

PDB Entry: 2a81, 3.15 Å

PDB Description: carboxymethylproline synthase (carb) from pectobacterium carotovora, complexed with acetyl coa and bicine

PDB Compounds: (C:) CarB

SCOPe Domain Sequences for d2a81c_:

Sequence; same for both SEQRES and ATOM records:

>d2a81c_ c.14.1.0 (C:) automated matches {Pectobacterium carotovorum [TaxId: 554]}
mvfeensdevrvitldhpnkhnpfsrtletsvkdalaranaddsvravvvyggaersfsa
ggdfnevkqlsrsedieewidrvidlyqavlnvnkptiaavdgyaigmgfqfalmfdqrl
mastanfvmpelkhgigcsvgaailgfthgfstmqeiiyqcqsldaprcvdyrlvnqvve
ssalldaaitqahvmasypasafintkravnkpfihlleqtrdaskavhka

Timeline for d2a81c_:

• d2a81c_ first appeared in SCOP 1.73, called d2a81c1
  
• d2a81c_ appears in SCOPe 2.06
  
• d2a81c_ appears in the current release, SCOPe 2.08