SCOP 1.73: Domain d2a81c1: 2a81 C:1-230

Lineage for d2a81c1 (2a81 C:1-230)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (4 families)

5. Family c.14.1.3: Crotonase-like [52103] (13 proteins)

6. Protein Carbapenem biosynthes protein CarB [142004] (1 species)

7. Species Pectobacterium carotovorum [TaxId:554] [142005] (2 PDB entries)

8. Domain d2a81c1: 2a81 C:1-230 [126385]
   automatically matched to 2A7K A:1-230
   complexed with aco, bcn

Details for d2a81c1

PDB Entry: 2a81, 3.15 Å

PDB Description: carboxymethylproline synthase (carb) from pectobacterium carotovora, complexed with acetyl coa and bicine

PDB Compounds: (C:) CarB

SCOP Domain Sequences for d2a81c1:

Sequence; same for both SEQRES and ATOM records:

>d2a81c1 c.14.1.3 (C:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]}
mvfeensdevrvitldhpnkhnpfsrtletsvkdalaranaddsvravvvyggaersfsa
ggdfnevkqlsrsedieewidrvidlyqavlnvnkptiaavdgyaigmgfqfalmfdqrl
mastanfvmpelkhgigcsvgaailgfthgfstmqeiiyqcqsldaprcvdyrlvnqvve
ssalldaaitqahvmasypasafintkravnkpfihlleqtrdaskavhk

Timeline for d2a81c1:

• d2a81c1 is new in SCOP 1.73
  
• d2a81c1 appears in SCOP 1.75
  
• d2a81c1 appears in the current release, SCOPe 2.08, called d2a81c_