Lineage for d2a81c_ (2a81 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2854146Species Pectobacterium carotovorum [TaxId:554] [255028] (1 PDB entry)
  8. 2854149Domain d2a81c_: 2a81 C: [126385]
    automated match to d4fzwc_
    complexed with aco, bcn

Details for d2a81c_

PDB Entry: 2a81 (more details), 3.15 Å

PDB Description: carboxymethylproline synthase (carb) from pectobacterium carotovora, complexed with acetyl coa and bicine
PDB Compounds: (C:) CarB

SCOPe Domain Sequences for d2a81c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a81c_ c.14.1.0 (C:) automated matches {Pectobacterium carotovorum [TaxId: 554]}
mvfeensdevrvitldhpnkhnpfsrtletsvkdalaranaddsvravvvyggaersfsa
ggdfnevkqlsrsedieewidrvidlyqavlnvnkptiaavdgyaigmgfqfalmfdqrl
mastanfvmpelkhgigcsvgaailgfthgfstmqeiiyqcqsldaprcvdyrlvnqvve
ssalldaaitqahvmasypasafintkravnkpfihlleqtrdaskavhka

SCOPe Domain Coordinates for d2a81c_:

Click to download the PDB-style file with coordinates for d2a81c_.
(The format of our PDB-style files is described here.)

Timeline for d2a81c_: