![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
![]() | Protein automated matches [190246] (70 species) not a true protein |
![]() | Species Pectobacterium carotovorum [TaxId:554] [255028] (1 PDB entry) |
![]() | Domain d2a81a_: 2a81 A: [126383] automated match to d4fzwc_ complexed with aco, bcn |
PDB Entry: 2a81 (more details), 3.15 Å
SCOPe Domain Sequences for d2a81a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a81a_ c.14.1.0 (A:) automated matches {Pectobacterium carotovorum [TaxId: 554]} mvfeensdevrvitldhpnkhnpfsrtletsvkdalaranaddsvravvvyggaersfsa ggdfnevkqlsrsedieewidrvidlyqavlnvnkptiaavdgyaigmgfqfalmfdqrl mastanfvmpelkhgigcsvgaailgfthgfstmqeiiyqcqsldaprcvdyrlvnqvve ssalldaaitqahvmasypasafintkravnkpfihlleqtrdaskavhkaafqa
Timeline for d2a81a_: