Lineage for d2a7ya1 (2a7y A:1-80)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665708Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (3 families) (S)
    contains insert beta-sheet subdomain and C-terminal helix
  5. 665742Family b.34.6.3: Rv2302-like [141248] (1 protein)
    different orientation for the extra C-terminal helix relative the SH3-like barrel
  6. 665743Protein Hypothetical protein Rv2302/MT2359 [141249] (1 species)
  7. 665744Species Mycobacterium tuberculosis [TaxId:1773] [141250] (1 PDB entry)
  8. 665745Domain d2a7ya1: 2a7y A:1-80 [126382]

Details for d2a7ya1

PDB Entry: 2a7y (more details)

PDB Description: solution structure of the conserved hypothetical protein rv2302 from the bacterium mycobacterium tuberculosis
PDB Compounds: (A:) Hypothetical protein Rv2302/MT2359

SCOP Domain Sequences for d2a7ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a7ya1 b.34.6.3 (A:1-80) Hypothetical protein Rv2302/MT2359 {Mycobacterium tuberculosis [TaxId: 1773]}
mhakvgdylvvkgttterhdqhaeiievrsadgsppyvvrwlvnghettvypgsdavvvt
atehaeaekraaaraghaat

SCOP Domain Coordinates for d2a7ya1:

Click to download the PDB-style file with coordinates for d2a7ya1.
(The format of our PDB-style files is described here.)

Timeline for d2a7ya1: