Class b: All beta proteins [48724] (165 folds) |
Fold b.34: SH3-like barrel [50036] (18 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (3 families) contains insert beta-sheet subdomain and C-terminal helix |
Family b.34.6.3: Rv2302-like [141248] (1 protein) different orientation for the extra C-terminal helix relative the SH3-like barrel |
Protein Hypothetical protein Rv2302/MT2359 [141249] (1 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [141250] (1 PDB entry) |
Domain d2a7ya1: 2a7y A:1-80 [126382] |
PDB Entry: 2a7y (more details)
SCOP Domain Sequences for d2a7ya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a7ya1 b.34.6.3 (A:1-80) Hypothetical protein Rv2302/MT2359 {Mycobacterium tuberculosis [TaxId: 1773]} mhakvgdylvvkgttterhdqhaeiievrsadgsppyvvrwlvnghettvypgsdavvvt atehaeaekraaaraghaat
Timeline for d2a7ya1: