Lineage for d2a7we_ (2a7w E:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
    multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer
  4. Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families) (S)
    basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat
  5. Family a.204.1.4: HisE-like (PRA-PH) [140797] (1 protein)
    Pfam PF01503
  6. Protein Phosphoribosyl-ATP pyrophosphatase HisE [140798] (5 species)
  7. Species Chromobacterium violaceum [TaxId:536] [140800] (1 PDB entry)
    Uniprot Q7P0E6 4-94
  8. Domain d2a7we_: 2a7w E: [126373]
    automated match to d2a7wa1

Details for d2a7we_

PDB Entry: 2a7w (more details), 2.8 Å

PDB Description: crystal structure of phosphoribosyl-atp pyrophosphatase from chromobacterium violaceum (atcc 12472). nesg target cvr7
PDB Compounds: (E:) Phosphoribosyl-ATP pyrophosphatase

SCOPe Domain Sequences for d2a7we_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a7we_ a.204.1.4 (E:) Phosphoribosyl-ATP pyrophosphatase HisE {Chromobacterium violaceum [TaxId: 536]}
dvlkniadtlearreaapqssyvaslfhkgedailkkvaeeaaetlmaskdkdklhlvre
vadlwfhtmvlltyhglrpedvvmelhrreg

SCOPe Domain Coordinates for d2a7we_ are not available.

Timeline for d2a7we_:

Domains from other chains:
(mouse over for more information)
d2a7wa1, d2a7wb_, d2a7wc_, d2a7wd_, d2a7wf_, d2a7wg_, d2a7wh_, d2a7wi_, d2a7wj_, d2a7wk_, d2a7wl_