Class a: All alpha proteins [46456] (289 folds) |
Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily) multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer |
Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families) basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat |
Family a.204.1.4: HisE-like (PRA-PH) [140797] (1 protein) Pfam PF01503 |
Protein Phosphoribosyl-ATP pyrophosphatase HisE [140798] (5 species) |
Species Chromobacterium violaceum [TaxId:536] [140800] (1 PDB entry) Uniprot Q7P0E6 4-94 |
Domain d2a7wc_: 2a7w C: [126371] automated match to d2a7wa1 |
PDB Entry: 2a7w (more details), 2.8 Å
SCOPe Domain Sequences for d2a7wc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a7wc_ a.204.1.4 (C:) Phosphoribosyl-ATP pyrophosphatase HisE {Chromobacterium violaceum [TaxId: 536]} dvlkniadtlearreaapqssyvaslfhkgedailkkvaeeaaetlmaskdkdklhlvre vadlwfhtmvlltyhglrpedvvmelhrreg
Timeline for d2a7wc_: