SCOPe 2.07: Domain d2a7ub1: 2a7u B:1-105

Lineage for d2a7ub1 (2a7u B:1-105)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.70: ATPD N-terminal domain-like [47927] (2 superfamilies)
   core: 5 helices; bundle

4. Superfamily a.70.1: N-terminal domain of the delta subunit of the F1F0-ATP synthase [47928] (1 family)
   automatically mapped to Pfam PF00213

5. Family a.70.1.1: N-terminal domain of the delta subunit of the F1F0-ATP synthase [47929] (1 protein)

6. Protein N-terminal domain of the delta subunit of the F1F0-ATP synthase [47930] (1 species)

7. Species Escherichia coli [TaxId:562] [47931] (2 PDB entries)

8. Domain d2a7ub1: 2a7u B:1-105 [126367]
   automatically matched to d1abv__

Details for d2a7ub1

PDB Entry: 2a7u

PDB Description: NMR solution structure of the E.coli F-ATPase delta subunit N-terminal domain in complex with alpha subunit N-terminal 22 residues

PDB Compounds: (B:) ATP synthase delta chain

SCOPe Domain Sequences for d2a7ub1:

Sequence; same for both SEQRES and ATOM records:

>d2a7ub1 a.70.1.1 (B:1-105) N-terminal domain of the delta subunit of the F1F0-ATP synthase {Escherichia coli [TaxId: 562]}
sefitvarpyakaafdfavehqsverwqdmlafaaevtkneqmaellsgalapetlaesf
iavcgeqldengqnlirvmaengrlnalpdvleqfihlravseat

Timeline for d2a7ub1:

• d2a7ub1 first appeared in SCOP 1.73
  
• d2a7ub1 appears in SCOPe 2.06
  
• d2a7ub1 appears in the current release, SCOPe 2.08