Lineage for d2a7ub1 (2a7u B:1-105)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717753Fold a.70: ATPD N-terminal domain-like [47927] (2 superfamilies)
    core: 5 helices; bundle
  4. 2717754Superfamily a.70.1: N-terminal domain of the delta subunit of the F1F0-ATP synthase [47928] (1 family) (S)
    automatically mapped to Pfam PF00213
  5. 2717755Family a.70.1.1: N-terminal domain of the delta subunit of the F1F0-ATP synthase [47929] (1 protein)
  6. 2717756Protein N-terminal domain of the delta subunit of the F1F0-ATP synthase [47930] (1 species)
  7. 2717757Species Escherichia coli [TaxId:562] [47931] (2 PDB entries)
  8. 2717759Domain d2a7ub1: 2a7u B:1-105 [126367]
    automatically matched to d1abv__

Details for d2a7ub1

PDB Entry: 2a7u (more details)

PDB Description: NMR solution structure of the E.coli F-ATPase delta subunit N-terminal domain in complex with alpha subunit N-terminal 22 residues
PDB Compounds: (B:) ATP synthase delta chain

SCOPe Domain Sequences for d2a7ub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a7ub1 a.70.1.1 (B:1-105) N-terminal domain of the delta subunit of the F1F0-ATP synthase {Escherichia coli [TaxId: 562]}
sefitvarpyakaafdfavehqsverwqdmlafaaevtkneqmaellsgalapetlaesf
iavcgeqldengqnlirvmaengrlnalpdvleqfihlravseat

SCOPe Domain Coordinates for d2a7ub1:

Click to download the PDB-style file with coordinates for d2a7ub1.
(The format of our PDB-style files is described here.)

Timeline for d2a7ub1: