![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.70: ATPD N-terminal domain-like [47927] (2 superfamilies) core: 5 helices; bundle |
![]() | Superfamily a.70.1: N-terminal domain of the delta subunit of the F1F0-ATP synthase [47928] (1 family) ![]() automatically mapped to Pfam PF00213 |
![]() | Family a.70.1.1: N-terminal domain of the delta subunit of the F1F0-ATP synthase [47929] (1 protein) |
![]() | Protein N-terminal domain of the delta subunit of the F1F0-ATP synthase [47930] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [47931] (2 PDB entries) |
![]() | Domain d2a7ub1: 2a7u B:1-105 [126367] automatically matched to d1abv__ |
PDB Entry: 2a7u (more details)
SCOPe Domain Sequences for d2a7ub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a7ub1 a.70.1.1 (B:1-105) N-terminal domain of the delta subunit of the F1F0-ATP synthase {Escherichia coli [TaxId: 562]} sefitvarpyakaafdfavehqsverwqdmlafaaevtkneqmaellsgalapetlaesf iavcgeqldengqnlirvmaengrlnalpdvleqfihlravseat
Timeline for d2a7ub1: